Lineage for d2ia5d2 (2ia5 D:1-152)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 695085Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 695086Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) (S)
    division into families based on beta-sheet topologies
  5. 695087Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (20 proteins)
    parallel beta-sheet of 5 strands, order 23145
  6. 695288Protein Polynucleotide kinase, kinase domain [75191] (1 species)
  7. 695289Species Bacteriophage T4 [TaxId:10665] [75192] (6 PDB entries)
  8. 695298Domain d2ia5d2: 2ia5 D:1-152 [137140]
    Other proteins in same PDB: d2ia5a1, d2ia5b1, d2ia5c1, d2ia5d1, d2ia5e1, d2ia5f1, d2ia5g1, d2ia5h1, d2ia5i1, d2ia5j1, d2ia5k1, d2ia5l1
    automatically matched to d1ltqa2
    complexed with ars, mg, so4

Details for d2ia5d2

PDB Entry: 2ia5 (more details), 2.9 Å

PDB Description: t4 polynucleotide kinase/phosphatase with bound sulfate and magnesium.
PDB Compounds: (D:) Polynucleotide kinase

SCOP Domain Sequences for d2ia5d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ia5d2 c.37.1.1 (D:1-152) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]}
mkkiiltigcpgsgkstwarefiaknpgfyninrddyrqsimaheerdeykytkkkegiv
tgmqfdtaksilyggdsvkgviisdtnlnperrlawetfakeygwkvehkvfdvpwtelv
krnskrgtkavpidvlrsmyksmreylglpvy

SCOP Domain Coordinates for d2ia5d2:

Click to download the PDB-style file with coordinates for d2ia5d2.
(The format of our PDB-style files is described here.)

Timeline for d2ia5d2: