Lineage for d2i9tb2 (2i9t B:339-550)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2040316Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2040931Superfamily b.2.5: p53-like transcription factors [49417] (8 families) (S)
  5. 2041189Family b.2.5.3: Rel/Dorsal transcription factors, DNA-binding domain [81315] (7 proteins)
    automatically mapped to Pfam PF00554
  6. 2041193Protein p50 subunit of NF-kappa B (NFKB), N-terminal domain [49423] (2 species)
  7. 2041197Species Mouse (Mus musculus) [TaxId:10090] [49425] (7 PDB entries)
  8. 2041202Domain d2i9tb2: 2i9t B:339-550 [137132]
    Other proteins in same PDB: d2i9ta1, d2i9ta2, d2i9ta3, d2i9tb1
    automated match to d1leib2
    protein/DNA complex

Details for d2i9tb2

PDB Entry: 2i9t (more details), 2.8 Å

PDB Description: structure of nf-kb p65-p50 heterodimer bound to prdii element of b- interferon promoter
PDB Compounds: (B:) Nuclear factor NF-kappa-B p105 subunit

SCOPe Domain Sequences for d2i9tb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2i9tb2 b.2.5.3 (B:339-550) p50 subunit of NF-kappa B (NFKB), N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}
gpylqileqpkqrgfrfryvcegpshgglpgasseknkksypqvkicnyvgpakvivqlv
tngknihlhahslvgkhcedgvctvtagpkdmvvgfanlgilhvtkkkvfetlearmtea
cirgynpgllvhsdlaylqaegggdrqltdrekeiirqaavqqtkemdlsvvrlmftafl
pdstgsftrrlepvvsdaiydskapnasnlki

SCOPe Domain Coordinates for d2i9tb2:

Click to download the PDB-style file with coordinates for d2i9tb2.
(The format of our PDB-style files is described here.)

Timeline for d2i9tb2: