Lineage for d2i9tb1 (2i9t B:548-650)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 658571Superfamily b.1.18: E set domains [81296] (20 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 658572Family b.1.18.1: NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain [81279] (7 proteins)
    subgroup of the larger IPT/TIG domain family
  6. 658584Protein p50 subunit of NF-kappa B transcription factor [49248] (2 species)
  7. 658598Species Mouse (Mus musculus) [TaxId:10090] [49250] (9 PDB entries)
  8. 658605Domain d2i9tb1: 2i9t B:548-650 [137131]
    Other proteins in same PDB: d2i9ta1, d2i9ta2, d2i9tb2
    automatically matched to d1iknc_

Details for d2i9tb1

PDB Entry: 2i9t (more details), 2.8 Å

PDB Description: structure of nf-kb p65-p50 heterodimer bound to prdii element of b- interferon promoter
PDB Compounds: (B:) Nuclear factor NF-kappa-B p105 subunit

SCOP Domain Sequences for d2i9tb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2i9tb1 b.1.18.1 (B:548-650) p50 subunit of NF-kappa B transcription factor {Mouse (Mus musculus) [TaxId: 10090]}
lkivrmdrtagcvtggeeiyllcdkvqkddiqirfyeeeenggvwegfgdfsptdvhrqf
aivfktpkykdvnitkpasvfvqlrrksdletsepkpflyype

SCOP Domain Coordinates for d2i9tb1:

Click to download the PDB-style file with coordinates for d2i9tb1.
(The format of our PDB-style files is described here.)

Timeline for d2i9tb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2i9tb2