![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.18: E set domains [81296] (27 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
![]() | Family b.1.18.1: NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain [81279] (8 proteins) subgroup of the larger IPT/TIG domain family |
![]() | Protein p50 subunit of NF-kappa B transcription factor [49248] (2 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [49250] (15 PDB entries) |
![]() | Domain d2i9tb1: 2i9t B:551-650 [137131] Other proteins in same PDB: d2i9ta1, d2i9ta2, d2i9ta3, d2i9tb2 automated match to d1leib1 protein/DNA complex |
PDB Entry: 2i9t (more details), 2.8 Å
SCOPe Domain Sequences for d2i9tb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2i9tb1 b.1.18.1 (B:551-650) p50 subunit of NF-kappa B transcription factor {Mouse (Mus musculus) [TaxId: 10090]} vrmdrtagcvtggeeiyllcdkvqkddiqirfyeeeenggvwegfgdfsptdvhrqfaiv fktpkykdvnitkpasvfvqlrrksdletsepkpflyype
Timeline for d2i9tb1: