SCOPe 2.06: Domain d2i9ta2: 2i9t A:19-190

Lineage for d2i9ta2 (2i9t A:19-190)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.5: p53-like transcription factors [49417] (8 families)

5. Family b.2.5.3: Rel/Dorsal transcription factors, DNA-binding domain [81315] (7 proteins)
   automatically mapped to Pfam PF00554

6. Protein p65 subunit of NF-kappa B (NFKB), N-terminal domain [49428] (3 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [49429] (8 PDB entries)

8. Domain d2i9ta2: 2i9t A:19-190 [137130]
   Other proteins in same PDB: d2i9ta1, d2i9ta3, d2i9tb1, d2i9tb2
   automated match to d1gjia2
   protein/DNA complex

Details for d2i9ta2

PDB Entry: 2i9t, 2.8 Å

PDB Description: structure of nf-kb p65-p50 heterodimer bound to prdii element of b- interferon promoter

PDB Compounds: (A:) Transcription factor p65

SCOPe Domain Sequences for d2i9ta2:

Sequence; same for both SEQRES and ATOM records:

>d2i9ta2 b.2.5.3 (A:19-190) p65 subunit of NF-kappa B (NFKB), N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}
pyveiieqpkqrgmrfrykcegrsagsipgerstdttkthptikingytgpgtvrislvt
kdpphrphphelvgkdcrdgyyeadlcpdrsihsfqnlgiqcvkkrdleqaisqriqtnn
npfhvpieeqrgdydlnavrlcfqvtvrdpagrpllltpvlshpifdnrapn

Timeline for d2i9ta2:

• d2i9ta2 first appeared in SCOP 1.73
  
• d2i9ta2 appears in SCOPe 2.05
  
• d2i9ta2 appears in SCOPe 2.07
  
• d2i9ta2 appears in the current release, SCOPe 2.08