SCOP 1.73: Domain d2i9ta2: 2i9t A:20-190

Lineage for d2i9ta2 (2i9t A:20-190)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.5: p53-like transcription factors [49417] (7 families)

5. Family b.2.5.3: Rel/Dorsal transcription factors, DNA-binding domain [81315] (6 proteins)

6. Protein p65 subunit of NF-kappa B (NFKB), N-terminal domain [49428] (3 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [49429] (8 PDB entries)

8. Domain d2i9ta2: 2i9t A:20-190 [137130]
   Other proteins in same PDB: d2i9ta1, d2i9tb1, d2i9tb2
   automatically matched to d1le5a2

Details for d2i9ta2

PDB Entry: 2i9t, 2.8 Å

PDB Description: structure of nf-kb p65-p50 heterodimer bound to prdii element of b- interferon promoter

PDB Compounds: (A:) Transcription factor p65

SCOP Domain Sequences for d2i9ta2:

Sequence; same for both SEQRES and ATOM records:

>d2i9ta2 b.2.5.3 (A:20-190) p65 subunit of NF-kappa B (NFKB), N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}
yveiieqpkqrgmrfrykcegrsagsipgerstdttkthptikingytgpgtvrislvtk
dpphrphphelvgkdcrdgyyeadlcpdrsihsfqnlgiqcvkkrdleqaisqriqtnnn
pfhvpieeqrgdydlnavrlcfqvtvrdpagrpllltpvlshpifdnrapn

Timeline for d2i9ta2:

• d2i9ta2 is new in SCOP 1.73
  
• d2i9ta2 appears in SCOP 1.75
  
• d2i9ta2 appears in the current release, SCOPe 2.08