![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
![]() | Superfamily b.2.5: p53-like transcription factors [49417] (8 families) ![]() |
![]() | Family b.2.5.3: Rel/Dorsal transcription factors, DNA-binding domain [81315] (7 proteins) automatically mapped to Pfam PF00554 |
![]() | Protein p65 subunit of NF-kappa B (NFKB), N-terminal domain [49428] (3 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [49429] (9 PDB entries) |
![]() | Domain d2i9ta2: 2i9t A:19-190 [137130] Other proteins in same PDB: d2i9ta1, d2i9ta3, d2i9tb1, d2i9tb2 automated match to d1gjia2 protein/DNA complex |
PDB Entry: 2i9t (more details), 2.8 Å
SCOPe Domain Sequences for d2i9ta2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2i9ta2 b.2.5.3 (A:19-190) p65 subunit of NF-kappa B (NFKB), N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} pyveiieqpkqrgmrfrykcegrsagsipgerstdttkthptikingytgpgtvrislvt kdpphrphphelvgkdcrdgyyeadlcpdrsihsfqnlgiqcvkkrdleqaisqriqtnn npfhvpieeqrgdydlnavrlcfqvtvrdpagrpllltpvlshpifdnrapn
Timeline for d2i9ta2: