![]() | Class a: All alpha proteins [46456] (258 folds) |
![]() | Fold a.60: SAM domain-like [47768] (15 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
![]() | Superfamily a.60.6: DNA polymerase beta, N-terminal domain-like [47802] (1 family) ![]() contains one classic and one pseudo HhH motifs |
![]() | Family a.60.6.1: DNA polymerase beta, N-terminal domain-like [47803] (3 proteins) |
![]() | Protein DNA polymerase beta, N-terminal (8 kD)-domain [47804] (2 species) topologically similar to the second domain |
![]() | Species Human (Homo sapiens) [TaxId:9606] [47805] (103 PDB entries) |
![]() | Domain d2i9ga1: 2i9g A:10-91 [137126] Other proteins in same PDB: d2i9ga2, d2i9ga3 automatically matched to d1bpxa1 complexed with bpi, cl, doc, na |
PDB Entry: 2i9g (more details), 2.1 Å
SCOP Domain Sequences for d2i9ga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2i9ga1 a.60.6.1 (A:10-91) DNA polymerase beta, N-terminal (8 kD)-domain {Human (Homo sapiens) [TaxId: 9606]} tlnggitdmltelanfeknvsqaihkynayrkaasviakyphkiksgaeakklpgvgtki aekideflatgklrklekirqd
Timeline for d2i9ga1: