![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
![]() | Superfamily g.3.11: EGF/Laminin [57196] (8 families) ![]() |
![]() | Family g.3.11.1: EGF-type module [57197] (23 proteins) |
![]() | Protein Plasminogen activator (urokinase-type) [57221] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [57222] (6 PDB entries) |
![]() | Domain d2i9ad1: 2i9a D:10-49 [137116] Other proteins in same PDB: d2i9aa2, d2i9ab2, d2i9ac2, d2i9ad2 automated match to d1urka1 complexed with po4 |
PDB Entry: 2i9a (more details), 1.9 Å
SCOPe Domain Sequences for d2i9ad1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2i9ad1 g.3.11.1 (D:10-49) Plasminogen activator (urokinase-type) {Human (Homo sapiens) [TaxId: 9606]} ncdclnggtcvsnkyfsnihwcncpkkfggqhceidkskt
Timeline for d2i9ad1: