Lineage for d2i9ac2 (2i9a C:50-133)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3033267Fold g.14: Kringle-like [57439] (1 superfamily)
    disulfide-rich fold; nearly all-beta
  4. 3033268Superfamily g.14.1: Kringle-like [57440] (3 families) (S)
  5. 3033269Family g.14.1.1: Kringle modules [57441] (7 proteins)
  6. 3033384Protein Urokinase-type plasminogen activator [57453] (1 species)
  7. 3033385Species Human (Homo sapiens) [TaxId:9606] [57454] (7 PDB entries)
  8. 3033388Domain d2i9ac2: 2i9a C:50-133 [137115]
    Other proteins in same PDB: d2i9aa1, d2i9ab1, d2i9ac1, d2i9ad1
    automated match to d1urka2
    complexed with po4

Details for d2i9ac2

PDB Entry: 2i9a (more details), 1.9 Å

PDB Description: crystal structure of the free aminoterminal fragment of urokinase type plasminogen activator (atf)
PDB Compounds: (C:) urokinase-type plasminogen activator

SCOPe Domain Sequences for d2i9ac2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2i9ac2 g.14.1.1 (C:50-133) Urokinase-type plasminogen activator {Human (Homo sapiens) [TaxId: 9606]}
cyegnghfyrgkastdtmgrpclpwnsatvlqqtyhahrsdalqlglgkhnycrnpdnrr
rpwcyvqvglkplvqecmvhdcad

SCOPe Domain Coordinates for d2i9ac2:

Click to download the PDB-style file with coordinates for d2i9ac2.
(The format of our PDB-style files is described here.)

Timeline for d2i9ac2: