| Class g: Small proteins [56992] (90 folds) |
| Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.11: EGF/Laminin [57196] (8 families) ![]() |
| Family g.3.11.1: EGF-type module [57197] (23 proteins) |
| Protein Plasminogen activator (urokinase-type) [57221] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [57222] (6 PDB entries) |
| Domain d2i9ab1: 2i9a B:10-49 [137112] Other proteins in same PDB: d2i9aa2, d2i9ab2, d2i9ac2, d2i9ad2 automatically matched to d1urk_1 complexed with po4 |
PDB Entry: 2i9a (more details), 1.9 Å
SCOPe Domain Sequences for d2i9ab1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2i9ab1 g.3.11.1 (B:10-49) Plasminogen activator (urokinase-type) {Human (Homo sapiens) [TaxId: 9606]}
ncdclnggtcvsnkyfsnihwcncpkkfggqhceidkskt
Timeline for d2i9ab1: