Class a: All alpha proteins [46456] (289 folds) |
Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (12 families) Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
Family a.39.1.5: Calmodulin-like [47502] (24 proteins) Duplication: made with two pairs of EF-hands |
Protein automated matches [190064] (21 species) not a true protein |
Species Cow (Bos taurus) [TaxId:9913] [228970] (3 PDB entries) |
Domain d2i94a_: 2i94 A: [137109] automated match to d2d8na_ complexed with ca |
PDB Entry: 2i94 (more details)
SCOPe Domain Sequences for d2i94a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2i94a_ a.39.1.5 (A:) automated matches {Cow (Bos taurus) [TaxId: 9913]} alskeileelqlntkfteeelsswyqsflkecpsgritrqefqtiyskffpeadpkayaq hvfrsfdansdgtldfkeyvialhmtsagktnqklewafslydvdgngtisknevleivt aifkmispedtkhlpedentpekraekiwgffgkkdddkltekefiegtlankeilrliq fe
Timeline for d2i94a_: