SCOPe 2.06: Domain d2i94a_: 2i94 A:

Lineage for d2i94a_ (2i94 A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
   Duplication: made with two pairs of EF-hands

6. Protein automated matches [190064] (21 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [228970] (3 PDB entries)

8. Domain d2i94a_: 2i94 A: [137109]
   automated match to d2d8na_
   complexed with ca

Details for d2i94a_

PDB Entry: 2i94

PDB Description: nmr structure of recoverin bound to rhodopsin kinase

PDB Compounds: (A:) Recoverin

SCOPe Domain Sequences for d2i94a_:

Sequence; same for both SEQRES and ATOM records:

>d2i94a_ a.39.1.5 (A:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
alskeileelqlntkfteeelsswyqsflkecpsgritrqefqtiyskffpeadpkayaq
hvfrsfdansdgtldfkeyvialhmtsagktnqklewafslydvdgngtisknevleivt
aifkmispedtkhlpedentpekraekiwgffgkkdddkltekefiegtlankeilrliq
fe

Timeline for d2i94a_:

• d2i94a_ first appeared in SCOP 1.73, called d2i94a1
  
• d2i94a_ appears in SCOPe 2.05
  
• d2i94a_ appears in SCOPe 2.07
  
• d2i94a_ appears in the current release, SCOPe 2.08