Lineage for d2i94a_ (2i94 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2710066Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2710067Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2710548Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
    Duplication: made with two pairs of EF-hands
  6. 2711203Protein automated matches [190064] (21 species)
    not a true protein
  7. 2711221Species Cow (Bos taurus) [TaxId:9913] [228970] (3 PDB entries)
  8. 2711224Domain d2i94a_: 2i94 A: [137109]
    automated match to d2d8na_
    complexed with ca

Details for d2i94a_

PDB Entry: 2i94 (more details)

PDB Description: nmr structure of recoverin bound to rhodopsin kinase
PDB Compounds: (A:) Recoverin

SCOPe Domain Sequences for d2i94a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2i94a_ a.39.1.5 (A:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
alskeileelqlntkfteeelsswyqsflkecpsgritrqefqtiyskffpeadpkayaq
hvfrsfdansdgtldfkeyvialhmtsagktnqklewafslydvdgngtisknevleivt
aifkmispedtkhlpedentpekraekiwgffgkkdddkltekefiegtlankeilrliq
fe

SCOPe Domain Coordinates for d2i94a_:

Click to download the PDB-style file with coordinates for d2i94a_.
(The format of our PDB-style files is described here.)

Timeline for d2i94a_: