Lineage for d2i91b2 (2i91 B:364-537)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892194Fold c.62: vWA-like [53299] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2892195Superfamily c.62.1: vWA-like [53300] (6 families) (S)
  5. 2892455Family c.62.1.5: RoRNP C-terminal domain-like [142565] (1 protein)
  6. 2892456Protein 60-kda SS-A/Ro ribonucleoprotein, RoRNP [142566] (1 species)
  7. 2892457Species African clawed frog (Xenopus laevis) [TaxId:8355] [142567] (3 PDB entries)
    Uniprot P42700 364-537
  8. 2892462Domain d2i91b2: 2i91 B:364-537 [137108]
    Other proteins in same PDB: d2i91a1, d2i91b1
    automated match to d1yvpa2
    protein/RNA complex; complexed with act, mg

Details for d2i91b2

PDB Entry: 2i91 (more details), 2.65 Å

PDB Description: 60kDa Ro autoantigen in complex with a fragment of misfolded RNA
PDB Compounds: (B:) 60 kDa SS-A/Ro ribonucleoprotein

SCOPe Domain Sequences for d2i91b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2i91b2 c.62.1.5 (B:364-537) 60-kda SS-A/Ro ribonucleoprotein, RoRNP {African clawed frog (Xenopus laevis) [TaxId: 8355]}
veptgkrfllaidvsasmnqrvlgsilnasvvaaamcmlvartekdshmvafsdemlpcp
itvnmllhevvekmsditmgstdcalpmlwaqktntaadifivftdcetnvedvhpatal
kqyrekmgipaklivcamtsngfsiadpddrgmldicgfdsgaldvirnftldl

SCOPe Domain Coordinates for d2i91b2:

Click to download the PDB-style file with coordinates for d2i91b2.
(The format of our PDB-style files is described here.)

Timeline for d2i91b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2i91b1