SCOP 1.75: Domain d2i91a2: 2i91 A:364-537

Lineage for d2i91a2 (2i91 A:364-537)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.62: vWA-like [53299] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.62.1: vWA-like [53300] (5 families)

5. Family c.62.1.5: RoRNP C-terminal domain-like [142565] (1 protein)

6. Protein 60-kda SS-A/Ro ribonucleoprotein, RoRNP [142566] (1 species)

7. Species African clawed frog (Xenopus laevis) [TaxId:8355] [142567] (3 PDB entries)
   Uniprot P42700 364-537

8. Domain d2i91a2: 2i91 A:364-537 [137106]
   Other proteins in same PDB: d2i91a1, d2i91b1
   automatically matched to 1YVP A:364-537
   complexed with act, mg

Details for d2i91a2

PDB Entry: 2i91, 2.65 Å

PDB Description: 60kDa Ro autoantigen in complex with a fragment of misfolded RNA

PDB Compounds: (A:) 60 kDa SS-A/Ro ribonucleoprotein

SCOP Domain Sequences for d2i91a2:

Sequence; same for both SEQRES and ATOM records:

>d2i91a2 c.62.1.5 (A:364-537) 60-kda SS-A/Ro ribonucleoprotein, RoRNP {African clawed frog (Xenopus laevis) [TaxId: 8355]}
veptgkrfllaidvsasmnqrvlgsilnasvvaaamcmlvartekdshmvafsdemlpcp
itvnmllhevvekmsditmgstdcalpmlwaqktntaadifivftdcetnvedvhpatal
kqyrekmgipaklivcamtsngfsiadpddrgmldicgfdsgaldvirnftldl

Timeline for d2i91a2:

• d2i91a2 first appeared in SCOP 1.73
  
• d2i91a2 appears in SCOPe 2.01
  
• d2i91a2 appears in the current release, SCOPe 2.08