Lineage for d2i83a_ (2i83 A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2607278Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 2607279Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 2607961Family d.169.1.4: Link domain [56477] (3 proteins)
  6. 2607962Protein CD44, hyaluronan binding domain [103353] (1 species)
    contains extra N-terminal beta-strand and C-terminal beta-hairpin
  7. 2607963Species Human (Homo sapiens) [TaxId:9606] [103354] (3 PDB entries)
  8. 2607966Domain d2i83a_: 2i83 A: [137104]
    automated match to d1poza_

Details for d2i83a_

PDB Entry: 2i83 (more details)

PDB Description: hyaluronan-binding domain of cd44 in its ligand-bound form
PDB Compounds: (A:) CD44 antigen

SCOPe Domain Sequences for d2i83a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2i83a_ d.169.1.4 (A:) CD44, hyaluronan binding domain {Human (Homo sapiens) [TaxId: 9606]}
qidlnitcrfagvfhvekngrysisrteaadlckafnstlptmaqmekalsigfetcryg
fieghvviprihpnsicaanntgvyiltsntsqydtycfnasappeedctsvtdlpnafd
gpititivnrdgtryvqkgeyrtnpediypsnptdddv

SCOPe Domain Coordinates for d2i83a_:

Click to download the PDB-style file with coordinates for d2i83a_.
(The format of our PDB-style files is described here.)

Timeline for d2i83a_: