Lineage for d2i83a1 (2i83 A:21-178)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 737894Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 737895Superfamily d.169.1: C-type lectin-like [56436] (8 families) (S)
  5. 738308Family d.169.1.4: Link domain [56477] (2 proteins)
  6. 738309Protein CD44, hyaluronan binding domain [103353] (1 species)
    contains extra N-terminal beta-strand and C-terminal beta-hairpin
  7. 738310Species Human (Homo sapiens) [TaxId:9606] [103354] (3 PDB entries)
  8. 738313Domain d2i83a1: 2i83 A:21-178 [137104]
    automatically matched to d1poza_

Details for d2i83a1

PDB Entry: 2i83 (more details)

PDB Description: hyaluronan-binding domain of cd44 in its ligand-bound form
PDB Compounds: (A:) CD44 antigen

SCOP Domain Sequences for d2i83a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2i83a1 d.169.1.4 (A:21-178) CD44, hyaluronan binding domain {Human (Homo sapiens) [TaxId: 9606]}
qidlnitcrfagvfhvekngrysisrteaadlckafnstlptmaqmekalsigfetcryg
fieghvviprihpnsicaanntgvyiltsntsqydtycfnasappeedctsvtdlpnafd
gpititivnrdgtryvqkgeyrtnpediypsnptdddv

SCOP Domain Coordinates for d2i83a1:

Click to download the PDB-style file with coordinates for d2i83a1.
(The format of our PDB-style files is described here.)

Timeline for d2i83a1: