Lineage for d2i7rb1 (2i7r B:1-115)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 720941Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 720942Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (10 families) (S)
  5. 720978Family d.32.1.2: Antibiotic resistance proteins [54598] (6 proteins)
    duplication: consists of two clear structural repeats each having this fold
    subunit fold and dimeric assembly are similar to those of glyoxalase
  6. 721028Protein Hypotheical protein SP0731 [143127] (1 species)
  7. 721029Species Streptococcus pneumoniae [TaxId:1313] [143128] (1 PDB entry)
  8. 721031Domain d2i7rb1: 2i7r B:1-115 [137103]
    automatically matched to 2I7R A:1-115

Details for d2i7rb1

PDB Entry: 2i7r (more details), 2.2 Å

PDB Description: conserved domain protein
PDB Compounds: (B:) conserved domain protein

SCOP Domain Sequences for d2i7rb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2i7rb1 d.32.1.2 (B:1-115) Hypotheical protein SP0731 {Streptococcus pneumoniae [TaxId: 1313]}
mnlnqldiivsnvpqvcadlehildkkadyandgfaqftigshclmlsqnhlvplenfqs
giiihievedvdqnykrlnelgikvlhgptvtdwgtesllvqgpaglvldfyrmk

SCOP Domain Coordinates for d2i7rb1:

Click to download the PDB-style file with coordinates for d2i7rb1.
(The format of our PDB-style files is described here.)

Timeline for d2i7rb1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2i7ra1