SCOP 1.73: Domain d2i7rb1: 2i7r B:1-115

Lineage for d2i7rb1 (2i7r B:1-115)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
   beta-alpha-beta(3); 2 layers: alpha/beta

4. Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (10 families)

5. Family d.32.1.2: Antibiotic resistance proteins [54598] (6 proteins)
   duplication: consists of two clear structural repeats each having this fold
   subunit fold and dimeric assembly are similar to those of glyoxalase

6. Protein Hypotheical protein SP0731 [143127] (1 species)

7. Species Streptococcus pneumoniae [TaxId:1313] [143128] (1 PDB entry)

8. Domain d2i7rb1: 2i7r B:1-115 [137103]
   automatically matched to 2I7R A:1-115

Details for d2i7rb1

PDB Entry: 2i7r, 2.2 Å

PDB Description: conserved domain protein

PDB Compounds: (B:) conserved domain protein

SCOP Domain Sequences for d2i7rb1:

Sequence; same for both SEQRES and ATOM records:

>d2i7rb1 d.32.1.2 (B:1-115) Hypotheical protein SP0731 {Streptococcus pneumoniae [TaxId: 1313]}
mnlnqldiivsnvpqvcadlehildkkadyandgfaqftigshclmlsqnhlvplenfqs
giiihievedvdqnykrlnelgikvlhgptvtdwgtesllvqgpaglvldfyrmk

Timeline for d2i7rb1:

• d2i7rb1 is new in SCOP 1.73
  
• d2i7rb1 appears in SCOP 1.75
  
• d2i7rb1 appears in the current release, SCOPe 2.08, called d2i7rb_