Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily) beta-alpha-beta(3); 2 layers: alpha/beta |
Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) |
Family d.32.1.2: Antibiotic resistance proteins [54598] (8 proteins) duplication: consists of two clear structural repeats each having this fold subunit fold and dimeric assembly are similar to those of glyoxalase |
Protein Hypotheical protein SP0731 [143127] (1 species) |
Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [143128] (1 PDB entry) Uniprot Q97RR3 1-115 |
Domain d2i7ra1: 2i7r A:1-115 [137102] Other proteins in same PDB: d2i7rb_ |
PDB Entry: 2i7r (more details), 2.2 Å
SCOPe Domain Sequences for d2i7ra1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2i7ra1 d.32.1.2 (A:1-115) Hypotheical protein SP0731 {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]} mnlnqldiivsnvpqvcadlehildkkadyandgfaqftigshclmlsqnhlvplenfqs giiihievedvdqnykrlnelgikvlhgptvtdwgtesllvqgpaglvldfyrmk
Timeline for d2i7ra1: