Lineage for d2i7ra1 (2i7r A:1-115)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2942376Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 2942377Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) (S)
  5. 2942433Family d.32.1.2: Antibiotic resistance proteins [54598] (8 proteins)
    duplication: consists of two clear structural repeats each having this fold
    subunit fold and dimeric assembly are similar to those of glyoxalase
  6. 2942483Protein Hypotheical protein SP0731 [143127] (1 species)
  7. 2942484Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [143128] (1 PDB entry)
    Uniprot Q97RR3 1-115
  8. 2942485Domain d2i7ra1: 2i7r A:1-115 [137102]
    Other proteins in same PDB: d2i7rb_

Details for d2i7ra1

PDB Entry: 2i7r (more details), 2.2 Å

PDB Description: conserved domain protein
PDB Compounds: (A:) conserved domain protein

SCOPe Domain Sequences for d2i7ra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2i7ra1 d.32.1.2 (A:1-115) Hypotheical protein SP0731 {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
mnlnqldiivsnvpqvcadlehildkkadyandgfaqftigshclmlsqnhlvplenfqs
giiihievedvdqnykrlnelgikvlhgptvtdwgtesllvqgpaglvldfyrmk

SCOPe Domain Coordinates for d2i7ra1:

Click to download the PDB-style file with coordinates for d2i7ra1.
(The format of our PDB-style files is described here.)

Timeline for d2i7ra1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2i7rb_