Lineage for d2i74b1 (2i74 B:472-651)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 662025Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 662026Superfamily b.18.1: Galactose-binding domain-like [49785] (30 families) (S)
  5. 662481Family b.18.1.29: Extended PAW domain [141113] (1 protein)
    single domain; the N-terminal half is covered by Pfam PF04721; DUF750 (Smart 00613; PAW), the C-terminal half by PfamB 028386
  6. 662482Protein Peptide:N-glycanase, PNGase, C-terminal domain [141114] (1 species)
  7. 662483Species Mouse (Mus musculus) [TaxId:10090] [141115] (3 PDB entries)
  8. 662485Domain d2i74b1: 2i74 B:472-651 [137101]
    automatically matched to 2I74 A:472-651
    complexed with act, gol, man

Details for d2i74b1

PDB Entry: 2i74 (more details), 1.75 Å

PDB Description: crystal structure of mouse peptide n-glycanase c-terminal domain in complex with mannopentaose
PDB Compounds: (B:) PNGase

SCOP Domain Sequences for d2i74b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2i74b1 b.18.1.29 (B:472-651) Peptide:N-glycanase, PNGase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}
erkeilfipsenekiskqfhlrydivrdryirvsdnntnisgwengvwkmesifrkvekd
wnmvylarkegssfayiswkfecgsaglkvdtvsirtssqsfesgsvrwklrsetaqvnl
lgdknlrsyndfsgatevtleaelsrgdgdvawqhtqlfrqslndsgengleiiitfndl

SCOP Domain Coordinates for d2i74b1:

Click to download the PDB-style file with coordinates for d2i74b1.
(The format of our PDB-style files is described here.)

Timeline for d2i74b1: