Lineage for d2i74b_ (2i74 B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2774100Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2774101Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2774897Family b.18.1.29: Extended PAW domain [141113] (1 protein)
    single domain; the N-terminal half is covered by Pfam PF04721; DUF750 (Smart 00613; PAW), the C-terminal half by PfamB PB028386
  6. 2774898Protein Peptide:N-glycanase, PNGase, C-terminal domain [141114] (1 species)
  7. 2774899Species Mouse (Mus musculus) [TaxId:10090] [141115] (3 PDB entries)
    Uniprot Q9JI78 454-561! Uniprot Q9JI78 472-651
  8. 2774903Domain d2i74b_: 2i74 B: [137101]
    automated match to d2g9fa1
    complexed with act, gol

Details for d2i74b_

PDB Entry: 2i74 (more details), 1.75 Å

PDB Description: crystal structure of mouse peptide n-glycanase c-terminal domain in complex with mannopentaose
PDB Compounds: (B:) PNGase

SCOPe Domain Sequences for d2i74b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2i74b_ b.18.1.29 (B:) Peptide:N-glycanase, PNGase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}
erkeilfipsenekiskqfhlrydivrdryirvsdnntnisgwengvwkmesifrkvekd
wnmvylarkegssfayiswkfecgsaglkvdtvsirtssqsfesgsvrwklrsetaqvnl
lgdknlrsyndfsgatevtleaelsrgdgdvawqhtqlfrqslndsgengleiiitfndl

SCOPe Domain Coordinates for d2i74b_:

Click to download the PDB-style file with coordinates for d2i74b_.
(The format of our PDB-style files is described here.)

Timeline for d2i74b_: