SCOPe 2.08: Domain d2i74a1: 2i74 A:472-651

Lineage for d2i74a1 (2i74 A:472-651)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll

4. Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families)

5. Family b.18.1.29: Extended PAW domain [141113] (1 protein)
   single domain; the N-terminal half is covered by Pfam PF04721; DUF750 (Smart 00613; PAW), the C-terminal half by PfamB PB028386

6. Protein Peptide:N-glycanase, PNGase, C-terminal domain [141114] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [141115] (3 PDB entries)
   Uniprot Q9JI78 454-561! Uniprot Q9JI78 472-651

8. Domain d2i74a1: 2i74 A:472-651 [137100]
   complexed with act, gol

Details for d2i74a1

PDB Entry: 2i74, 1.75 Å

PDB Description: crystal structure of mouse peptide n-glycanase c-terminal domain in complex with mannopentaose

PDB Compounds: (A:) PNGase

SCOPe Domain Sequences for d2i74a1:

Sequence; same for both SEQRES and ATOM records:

>d2i74a1 b.18.1.29 (A:472-651) Peptide:N-glycanase, PNGase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}
erkeilfipsenekiskqfhlrydivrdryirvsdnntnisgwengvwkmesifrkvekd
wnmvylarkegssfayiswkfecgsaglkvdtvsirtssqsfesgsvrwklrsetaqvnl
lgdknlrsyndfsgatevtleaelsrgdgdvawqhtqlfrqslndsgengleiiitfndl

Timeline for d2i74a1:

• d2i74a1 first appeared in SCOP 1.73
  
• d2i74a1 appears in SCOPe 2.07