![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
![]() | Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) ![]() |
![]() | Family c.66.1.44: TehB-like [142603] (2 proteins) Pfam PF03848; overall structural similarity to Thiopurine S-methyltransferase (Pfam PF05724) |
![]() | Protein Putative methyltransferase TehB [142604] (1 species) Tellurite resistance protein |
![]() | Species Salmonella typhimurium [TaxId:90371] [142605] (1 PDB entry) Uniprot Q8ZPC3 1-198 sequence similarity to Hypothetical methyltransferase PH1305 of the CAC2371-like family (117688) |
![]() | Domain d2i6gb2: 2i6g B:1-198 [137097] Other proteins in same PDB: d2i6ga2, d2i6gb3 automated match to d2i6ga1 complexed with acy, cl, edo |
PDB Entry: 2i6g (more details), 1.9 Å
SCOPe Domain Sequences for d2i6gb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2i6gb2 c.66.1.44 (B:1-198) Putative methyltransferase TehB {Salmonella typhimurium [TaxId: 90371]} mtvrdenyftekygltrthsdvlaaakvvapgrtldlgcgngrnslylaangydvtawdk npasmanlerikaaegldnlqtdlvdlntltfdgeydfilstvvmmfleaqtipglianm qrctkpggynlivaamdtpdfpctvgfpfafkegelrryyegwdmlkynedvgelhrtde ngnriklrfatmlarkta
Timeline for d2i6gb2: