Lineage for d2i6ca1 (2i6c A:1001-1160)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1214850Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 1214851Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 1214852Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)
  6. 1215129Protein Putative acetyltransferase PA4794 [143700] (1 species)
  7. 1215130Species Pseudomonas aeruginosa [TaxId:287] [143701] (4 PDB entries)
    Uniprot Q9HV14 1-160
  8. 1215132Domain d2i6ca1: 2i6c A:1001-1160 [137095]
    complexed with cl, epe, so4

Details for d2i6ca1

PDB Entry: 2i6c (more details), 1.3 Å

PDB Description: Crystal structure of putative acetyltransferase (GNAT family) from Pseudomonas aeruginosa PAO1
PDB Compounds: (A:) putative acetyltransferase

SCOPe Domain Sequences for d2i6ca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2i6ca1 d.108.1.1 (A:1001-1160) Putative acetyltransferase PA4794 {Pseudomonas aeruginosa [TaxId: 287]}
mqlshrpaetgdletvagfpqdrdelfycypkaiwpfsvaqlaaaiaerrgstvavhdgq
vlgfanfyqwqhgdfcalgnmmvapaarglgvaryligvmenlareqykarlmkiscfna
naaglllytqlgyqpraiaerhdpdgrrvaliqmdkplep

SCOPe Domain Coordinates for d2i6ca1:

Click to download the PDB-style file with coordinates for d2i6ca1.
(The format of our PDB-style files is described here.)

Timeline for d2i6ca1: