Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.72: Ribokinase-like [53612] (3 superfamilies) core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest potential superfamily: members of this fold have similar functions but different ATP-binding sites |
Superfamily c.72.1: Ribokinase-like [53613] (6 families) has extra strand located between strands 2 and 3 |
Family c.72.1.1: Ribokinase-like [53614] (10 proteins) |
Protein Adenosine kinase [53617] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [53618] (3 PDB entries) |
Domain d2i6ad_: 2i6a D: [137094] automated match to d1bx4a_ complexed with 5i5 |
PDB Entry: 2i6a (more details), 2.2 Å
SCOPe Domain Sequences for d2i6ad_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2i6ad_ c.72.1.1 (D:) Adenosine kinase {Human (Homo sapiens) [TaxId: 9606]} svrenilfgmgnplldisavvdkdfldkyslkpndqilaedkhkelfdelvkkfkveyha ggstqnsikvaqwmiqqphkaatffgcigidkfgeilkrkaaeahvdahyyeqneqptgt caacitgdnrslianlaaancykkekhldleknwmlvekarvcyiagffltvspesvlkv ahhasennriftlnlsapfisqfykeslmkvmpyvdilfgneteaatfareqgfetkdik eiakktqalpkmnskrqriviftqgrddtimatesevtafavldqdqkeiidtngagdaf vggflsqlvsdkplteciraghyaasiiirrtgctfpekpdfh
Timeline for d2i6ad_: