SCOP 1.73: Domain d2i6ad1: 2i6a D:4-345

Lineage for d2i6ad1 (2i6a D:4-345)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.72: Ribokinase-like [53612] (3 superfamilies)
   core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
   potential superfamily: members of this fold have similar functions but different ATP-binding sites

4. Superfamily c.72.1: Ribokinase-like [53613] (5 families)
   has extra strand located between strands 2 and 3

5. Family c.72.1.1: Ribokinase-like [53614] (9 proteins)

6. Protein Adenosine kinase [53617] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [53618] (2 PDB entries)

8. Domain d2i6ad1: 2i6a D:4-345 [137094]
   automatically matched to d1bx4a_
   complexed with 5i5

Details for d2i6ad1

PDB Entry: 2i6a, 2.2 Å

PDB Description: human adenosine kinase in complex with 5'-deoxy-5-iodotubercidin

PDB Compounds: (D:) adenosine kinase

SCOP Domain Sequences for d2i6ad1:

Sequence; same for both SEQRES and ATOM records:

>d2i6ad1 c.72.1.1 (D:4-345) Adenosine kinase {Human (Homo sapiens) [TaxId: 9606]}
vrenilfgmgnplldisavvdkdfldkyslkpndqilaedkhkelfdelvkkfkveyhag
gstqnsikvaqwmiqqphkaatffgcigidkfgeilkrkaaeahvdahyyeqneqptgtc
aacitgdnrslianlaaancykkekhldleknwmlvekarvcyiagffltvspesvlkva
hhasennriftlnlsapfisqfykeslmkvmpyvdilfgneteaatfareqgfetkdike
iakktqalpkmnskrqriviftqgrddtimatesevtafavldqdqkeiidtngagdafv
ggflsqlvsdkplteciraghyaasiiirrtgctfpekpdfh

Timeline for d2i6ad1:

• d2i6ad1 is new in SCOP 1.73
  
• d2i6ad1 appears in SCOP 1.75
  
• d2i6ad1 appears in the current release, SCOPe 2.08, called d2i6ad_