Lineage for d2i6ad_ (2i6a D:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.72: Ribokinase-like [53612] (3 superfamilies)
    core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
    potential superfamily: members of this fold have similar functions but different ATP-binding sites
  4. Superfamily c.72.1: Ribokinase-like [53613] (6 families) (S)
    has extra strand located between strands 2 and 3
  5. Family c.72.1.1: Ribokinase-like [53614] (10 proteins)
    automatically mapped to Pfam PF00294
  6. Protein Adenosine kinase [53617] (3 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [53618] (4 PDB entries)
  8. Domain d2i6ad_: 2i6a D: [137094]
    automated match to d1bx4a_
    complexed with 5i5

Details for d2i6ad_

PDB Entry: 2i6a (more details), 2.2 Å

PDB Description: human adenosine kinase in complex with 5'-deoxy-5-iodotubercidin
PDB Compounds: (D:) adenosine kinase

SCOPe Domain Sequences for d2i6ad_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2i6ad_ c.72.1.1 (D:) Adenosine kinase {Human (Homo sapiens) [TaxId: 9606]}
svrenilfgmgnplldisavvdkdfldkyslkpndqilaedkhkelfdelvkkfkveyha
ggstqnsikvaqwmiqqphkaatffgcigidkfgeilkrkaaeahvdahyyeqneqptgt
caacitgdnrslianlaaancykkekhldleknwmlvekarvcyiagffltvspesvlkv
ahhasennriftlnlsapfisqfykeslmkvmpyvdilfgneteaatfareqgfetkdik
eiakktqalpkmnskrqriviftqgrddtimatesevtafavldqdqkeiidtngagdaf
vggflsqlvsdkplteciraghyaasiiirrtgctfpekpdfh

SCOPe Domain Coordinates for d2i6ad_ are not available.

Timeline for d2i6ad_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2i6aa_, d2i6ab_, d2i6ac_