SCOPe 2.08: Domain d2i6ac_: 2i6a C:

Lineage for d2i6ac_ (2i6a C:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.72: Ribokinase-like [53612] (3 superfamilies)
   core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
   potential superfamily: members of this fold have similar functions but different ATP-binding sites

4. Superfamily c.72.1: Ribokinase-like [53613] (6 families)
   has extra strand located between strands 2 and 3

5. Family c.72.1.1: Ribokinase-like [53614] (10 proteins)
   automatically mapped to Pfam PF00294

6. Protein Adenosine kinase [53617] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [53618] (4 PDB entries)

8. Domain d2i6ac_: 2i6a C: [137093]
   automated match to d1bx4a_
   complexed with 5i5

Details for d2i6ac_

PDB Entry: 2i6a, 2.2 Å

PDB Description: human adenosine kinase in complex with 5'-deoxy-5-iodotubercidin

PDB Compounds: (C:) adenosine kinase

SCOPe Domain Sequences for d2i6ac_:

Sequence; same for both SEQRES and ATOM records:

>d2i6ac_ c.72.1.1 (C:) Adenosine kinase {Human (Homo sapiens) [TaxId: 9606]}
svrenilfgmgnplldisavvdkdfldkyslkpndqilaedkhkelfdelvkkfkveyha
ggstqnsikvaqwmiqqphkaatffgcigidkfgeilkrkaaeahvdahyyeqneqptgt
caacitgdnrslianlaaancykkekhldleknwmlvekarvcyiagffltvspesvlkv
ahhasennriftlnlsapfisqfykeslmkvmpyvdilfgneteaatfareqgfetkdik
eiakktqalpkmnskrqriviftqgrddtimatesevtafavldqdqkeiidtngagdaf
vggflsqlvsdkplteciraghyaasiiirrtgctfpekpdfh

Timeline for d2i6ac_:

• d2i6ac_ first appeared in SCOP 1.73, called d2i6ac1
  
• d2i6ac_ appears in SCOPe 2.07