Lineage for d2i6ab1 (2i6a B:4-345)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 843354Fold c.72: Ribokinase-like [53612] (3 superfamilies)
    core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
    potential superfamily: members of this fold have similar functions but different ATP-binding sites
  4. 843355Superfamily c.72.1: Ribokinase-like [53613] (5 families) (S)
    has extra strand located between strands 2 and 3
  5. 843356Family c.72.1.1: Ribokinase-like [53614] (9 proteins)
  6. 843376Protein Adenosine kinase [53617] (2 species)
  7. 843377Species Human (Homo sapiens) [TaxId:9606] [53618] (2 PDB entries)
  8. 843380Domain d2i6ab1: 2i6a B:4-345 [137092]
    automatically matched to d1bx4a_
    complexed with 5i5

Details for d2i6ab1

PDB Entry: 2i6a (more details), 2.2 Å

PDB Description: human adenosine kinase in complex with 5'-deoxy-5-iodotubercidin
PDB Compounds: (B:) adenosine kinase

SCOP Domain Sequences for d2i6ab1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2i6ab1 c.72.1.1 (B:4-345) Adenosine kinase {Human (Homo sapiens) [TaxId: 9606]}
vrenilfgmgnplldisavvdkdfldkyslkpndqilaedkhkelfdelvkkfkveyhag
gstqnsikvaqwmiqqphkaatffgcigidkfgeilkrkaaeahvdahyyeqneqptgtc
aacitgdnrslianlaaancykkekhldleknwmlvekarvcyiagffltvspesvlkva
hhasennriftlnlsapfisqfykeslmkvmpyvdilfgneteaatfareqgfetkdike
iakktqalpkmnskrqriviftqgrddtimatesevtafavldqdqkeiidtngagdafv
ggflsqlvsdkplteciraghyaasiiirrtgctfpekpdfh

SCOP Domain Coordinates for d2i6ab1:

Click to download the PDB-style file with coordinates for d2i6ab1.
(The format of our PDB-style files is described here.)

Timeline for d2i6ab1: