![]() | Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
![]() | Fold c.72: Ribokinase-like [53612] (3 superfamilies) core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest potential superfamily: members of this fold have similar functions but different ATP-binding sites |
![]() | Superfamily c.72.1: Ribokinase-like [53613] (5 families) ![]() has extra strand located between strands 2 and 3 |
![]() | Family c.72.1.1: Ribokinase-like [53614] (9 proteins) |
![]() | Protein Adenosine kinase [53617] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [53618] (2 PDB entries) |
![]() | Domain d2i6aa1: 2i6a A:4-345 [137091] automatically matched to d1bx4a_ complexed with 5i5 |
PDB Entry: 2i6a (more details), 2.2 Å
SCOP Domain Sequences for d2i6aa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2i6aa1 c.72.1.1 (A:4-345) Adenosine kinase {Human (Homo sapiens) [TaxId: 9606]} vrenilfgmgnplldisavvdkdfldkyslkpndqilaedkhkelfdelvkkfkveyhag gstqnsikvaqwmiqqphkaatffgcigidkfgeilkrkaaeahvdahyyeqneqptgtc aacitgdnrslianlaaancykkekhldleknwmlvekarvcyiagffltvspesvlkva hhasennriftlnlsapfisqfykeslmkvmpyvdilfgneteaatfareqgfetkdike iakktqalpkmnskrqriviftqgrddtimatesevtafavldqdqkeiidtngagdafv ggflsqlvsdkplteciraghyaasiiirrtgctfpekpdfh
Timeline for d2i6aa1: