SCOP 1.75: Domain d2i60r2: 2i60 R:114-214

Lineage for d2i60r2 (2i60 R:114-214)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (7 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88575] (172 PDB entries)
   Uniprot Q6N089 20-243 # 95% sequence identity; natural chimera: antibody heavy chain (Fab HYB3)
   SQ NA # humanized antibody
   Uniprot P01857 # IGHG1_HUMAN Ig gamma-1 chain C region
   SQ NA # engineered antibody
   including humanized antibodies (chimeric proteins with human constant domains)
   Uniprot Q6N089 20-243 # 95% sequence identity; natural chimera: antibody heavy chain (Fab HYB3) ! SQ NA # humanized antibody ! Uniprot P01857 # IGHG1_HUMAN Ig gamma-1 chain C region ! SQ NA # engineered antibody

8. Domain d2i60r2: 2i60 R:114-214 [137090]
   Other proteins in same PDB: d2i60g1, d2i60h1, d2i60l1, d2i60l2, d2i60m1, d2i60p1, d2i60q1, d2i60q2, d2i60r1, d2i60s1
   automatically matched to d1ngzb2
   complexed with ipa, mpt, nag, ndg, vlm

Details for d2i60r2

PDB Entry: 2i60, 2.4 Å

PDB Description: crystal structure of [phe23]m47, a scorpion-toxin mimic of cd4, in complex with hiv-1 yu2 gp120 envelope glycoprotein and anti-hiv-1 antibody 17b

PDB Compounds: (R:) Antibody 17B Heavy chain

SCOP Domain Sequences for d2i60r2:

Sequence, based on SEQRES records:

>d2i60r2 b.1.1.2 (R:114-214) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk

Sequence, based on observed residues (ATOM records):

>d2i60r2 b.1.1.2 (R:114-214) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
astkgpsvfplapgtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglyslss
vvtvpssslgtqtyicnvnhkpsntkvdkkvepk

Timeline for d2i60r2:

• d2i60r2 first appeared in SCOP 1.73
  
• d2i60r2 appears in SCOPe 2.01
  
• d2i60r2 appears in the current release, SCOPe 2.08