SCOP 1.73: Domain d2i60q2: 2i60 Q:108-212

Lineage for d2i60q2 (2i60 Q:108-212)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88569] (125 PDB entries)
   including humanized antibodies (chimeric proteins with human constant domains)

8. Domain d2i60q2: 2i60 Q:108-212 [137088]
   Other proteins in same PDB: d2i60g1, d2i60h1, d2i60h2, d2i60l1, d2i60p1, d2i60q1, d2i60r1, d2i60r2
   automatically matched to d1g9ml2
   complexed with ipa, mpt, nag, ndg, vlm

Details for d2i60q2

PDB Entry: 2i60, 2.4 Å

PDB Description: crystal structure of [phe23]m47, a scorpion-toxin mimic of cd4, in complex with hiv-1 yu2 gp120 envelope glycoprotein and anti-hiv-1 antibody 17b

PDB Compounds: (Q:) Antibody 17B Light chain

SCOP Domain Sequences for d2i60q2:

Sequence; same for both SEQRES and ATOM records:

>d2i60q2 b.1.1.2 (Q:108-212) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrg

Timeline for d2i60q2:

• d2i60q2 is new in SCOP 1.73
  
• d2i60q2 appears in SCOP 1.75
  
• d2i60q2 appears in the current release, SCOPe 2.08