Lineage for d2i60h1 (2i60 H:2-113)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. Species Human (Homo sapiens), cluster 1 [TaxId:9606] [88544] (37 PDB entries)
  8. Domain d2i60h1: 2i60 H:2-113 [137082]
    Other proteins in same PDB: d2i60g_, d2i60h2, d2i60l1, d2i60l2, d2i60m1, d2i60p2, d2i60p3, d2i60q1, d2i60q2, d2i60r2, d2i60s1
    automatically matched to d1rz8b1
    complexed with ipa, nag

Details for d2i60h1

PDB Entry: 2i60 (more details), 2.4 Å

PDB Description: crystal structure of [phe23]m47, a scorpion-toxin mimic of cd4, in complex with hiv-1 yu2 gp120 envelope glycoprotein and anti-hiv-1 antibody 17b
PDB Compounds: (H:) Antibody 17B Heavy chain

SCOPe Domain Sequences for d2i60h1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2i60h1 b.1.1.1 (H:2-113) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]}
vqlvesgaevkkpgssvkvsckasgdtfirysftwvrqapgqglewmgriitildvahya
phlqgrvtitadkststvylelrnlrsddtavyfcagvyegeadegeydnngflkhwgqg
tlvtvss

SCOPe Domain Coordinates for d2i60h1 are not available.

Timeline for d2i60h1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2i60h2
View in 3D
Domains from other chains:
(mouse over for more information)
d2i60g_, d2i60l1, d2i60l2, d2i60m1, d2i60p2, d2i60p3, d2i60q1, d2i60q2, d2i60r1, d2i60r2, d2i60s1