Lineage for d2i5yr1 (2i5y R:1-113)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2739730Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2739829Species Human (Homo sapiens), cluster 1 [TaxId:9606] [88544] (37 PDB entries)
  8. 2739855Domain d2i5yr1: 2i5y R:1-113 [137079]
    Other proteins in same PDB: d2i5yg2, d2i5yg3, d2i5yh2, d2i5yl1, d2i5yl2, d2i5ym1, d2i5yp2, d2i5yp3, d2i5yq1, d2i5yq2, d2i5yr2, d2i5ys1
    automatically matched to d1rz8b1
    complexed with nag

Details for d2i5yr1

PDB Entry: 2i5y (more details), 2.2 Å

PDB Description: crystal structure of cd4m47, a scorpion-toxin mimic of cd4, in complex with hiv-1 yu2 gp120 envelope glycoprotein and anti-hiv-1 antibody 17b
PDB Compounds: (R:) Antibody 17B Heavy chain

SCOPe Domain Sequences for d2i5yr1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2i5yr1 b.1.1.1 (R:1-113) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]}
evqlvesgaevkkpgssvkvsckasgdtfirysftwvrqapgqglewmgriitildvahy
aphlqgrvtitadkststvylelrnlrsddtavyfcagvyegeadegeydnngflkhwgq
gtlvtvss

SCOPe Domain Coordinates for d2i5yr1:

Click to download the PDB-style file with coordinates for d2i5yr1.
(The format of our PDB-style files is described here.)

Timeline for d2i5yr1: