Lineage for d2i5yp_ (2i5y P:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1941821Fold d.172: gp120 core [56501] (1 superfamily)
    unusual fold
  4. 1941822Superfamily d.172.1: gp120 core [56502] (1 family) (S)
  5. 1941823Family d.172.1.1: gp120 core [56503] (2 proteins)
  6. 1941824Protein gp120 core [56504] (2 species)
  7. 1941846Species Human immunodeficiency virus [TaxId:12721] [190021] (1 PDB entry)
  8. 1941848Domain d2i5yp_: 2i5y P: [137076]
    Other proteins in same PDB: d2i5yh1, d2i5yh2, d2i5yl1, d2i5yl2, d2i5ym1, d2i5yq1, d2i5yq2, d2i5yr1, d2i5yr2, d2i5ys1
    automated match to d1g9ng_
    complexed with nag, ndg

Details for d2i5yp_

PDB Entry: 2i5y (more details), 2.2 Å

PDB Description: crystal structure of cd4m47, a scorpion-toxin mimic of cd4, in complex with hiv-1 yu2 gp120 envelope glycoprotein and anti-hiv-1 antibody 17b
PDB Compounds: (P:) Exterior membrane glycoprotein(GP120)

SCOPe Domain Sequences for d2i5yp_:

Sequence, based on SEQRES records: (download)

>d2i5yp_ d.172.1.1 (P:) gp120 core {Human immunodeficiency virus [TaxId: 12721]}
sevklenvtenfnmwknnmveqmhediislwdqslkpcvkltplcvgagscntsvitqac
pkvsfepipihycapagfailkcndkkfngtgpctnvstvqcthgirpvvstqlllngsl
aeeeivirsenftnnaktiivqlnesvvinctgaghcnlsktqwentleqiaiklkeqfg
nnktiifnpssggdpeivthsfncggeffycnstqlftwndtrklnntgrnitlpcrikq
iinmwqevgkamyappirgqircssnitgllltrdggkdtngteifrpgggdmrdnwrse
lykykvvkie

Sequence, based on observed residues (ATOM records): (download)

>d2i5yp_ d.172.1.1 (P:) gp120 core {Human immunodeficiency virus [TaxId: 12721]}
sevklenvtenfnmwknnmveqmhediislwdqslkpcvkltplcvgagscntsvitqac
pkvsfepipihycapagfailkcndkkfngtgpctnvstvqcthgirpvvstqlllngsl
aeeeivirsenftnnaktiivqlnesvvinctgaghcnlsktqwentleqiaiklkeqfg
nnktiifnpssggdpeivthsfncggeffycnstqlftwrnitlpcrikqiinmwqevgk
amyappirgqircssnitgllltrdggkdtngteifrpgggdmrdnwrselykykvvkie

SCOPe Domain Coordinates for d2i5yp_:

Click to download the PDB-style file with coordinates for d2i5yp_.
(The format of our PDB-style files is described here.)

Timeline for d2i5yp_: