Lineage for d2i5yl2 (2i5y L:108-212)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2356941Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2360179Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (4 species)
  7. 2360180Species Human (Homo sapiens) [TaxId:9606] [88569] (151 PDB entries)
    including humanized antibodies (chimeric proteins with human constant domains)
    SQ NA # humanized antibody ! Uniprot P01834 # KAC_HUMAN Ig kappa chain C region ! SQ P01834 # KAC_HUMAN Ig kappa chain C region. ! SQ NA # engineered antibody
  8. 2360294Domain d2i5yl2: 2i5y L:108-212 [137075]
    Other proteins in same PDB: d2i5yg2, d2i5yg3, d2i5yh1, d2i5yh2, d2i5yl1, d2i5ym1, d2i5yp2, d2i5yp3, d2i5yq1, d2i5yr1, d2i5yr2, d2i5ys1
    automatically matched to d1g9ml2
    complexed with nag, ndg

Details for d2i5yl2

PDB Entry: 2i5y (more details), 2.2 Å

PDB Description: crystal structure of cd4m47, a scorpion-toxin mimic of cd4, in complex with hiv-1 yu2 gp120 envelope glycoprotein and anti-hiv-1 antibody 17b
PDB Compounds: (L:) Antibody 17B Light chain

SCOPe Domain Sequences for d2i5yl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2i5yl2 b.1.1.2 (L:108-212) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrg

SCOPe Domain Coordinates for d2i5yl2:

Click to download the PDB-style file with coordinates for d2i5yl2.
(The format of our PDB-style files is described here.)

Timeline for d2i5yl2: