| Class b: All beta proteins [48724] (165 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
| Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species) |
| Species Human (Homo sapiens) [TaxId:9606] [88569] (125 PDB entries) including humanized antibodies (chimeric proteins with human constant domains) |
| Domain d2i5yl2: 2i5y L:108-212 [137075] Other proteins in same PDB: d2i5yg1, d2i5yh1, d2i5yh2, d2i5yl1, d2i5yp1, d2i5yq1, d2i5yr1, d2i5yr2 automatically matched to d1g9ml2 complexed with bif, mpt, nag, ndg, vlm |
PDB Entry: 2i5y (more details), 2.2 Å
SCOP Domain Sequences for d2i5yl2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2i5yl2 b.1.1.2 (L:108-212) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrg
Timeline for d2i5yl2: