SCOPe 2.07: Domain d2i5wa2: 2i5w A:12-135

Lineage for d2i5wa2 (2i5w A:12-135)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.129: TBP-like [55944] (11 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.1: TATA-box binding protein-like [55945] (3 families)

5. Family d.129.1.2: DNA repair glycosylase, N-terminal domain [55952] (3 proteins)
   contains a single copy of this fold

6. Protein 8-oxoguanine glycosylase [55955] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [55956] (24 PDB entries)

8. Domain d2i5wa2: 2i5w A:12-135 [137070]
   Other proteins in same PDB: d2i5wa1, d2i5wa3
   automatically matched to d1ebma2
   protein/DNA complex; complexed with ca, gol

Details for d2i5wa2

PDB Entry: 2i5w, 2.6 Å

PDB Description: structure of hogg1 crosslinked to dna sampling a normal g adjacent to an oxog

PDB Compounds: (A:) N-glycosylase/DNA lyase

SCOPe Domain Sequences for d2i5wa2:

Sequence, based on SEQRES records:

>d2i5wa2 d.129.1.2 (A:12-135) 8-oxoguanine glycosylase {Human (Homo sapiens) [TaxId: 9606]}
ghrtlastpalwasipcprselrldlvlpsgqsfrwreqspahwsgvladqvwtltqtee
qlhctvyrgdksqasrptpdeleavrkyfqldvtlaqlyhhwgsvdshfqevaqkfqgvr
llrq

Sequence, based on observed residues (ATOM records):

>d2i5wa2 d.129.1.2 (A:12-135) 8-oxoguanine glycosylase {Human (Homo sapiens) [TaxId: 9606]}
ghrtlastpalwasipcprselrldlvlpsgqsfrwreqspahwsgvladqvwtltqtee
qlhctvyrqasrptpdeleavrkyfqldvtlaqlyhhwgsvdshfqevaqkfqgvrllrq

Timeline for d2i5wa2:

• d2i5wa2 first appeared in SCOP 1.73
  
• d2i5wa2 appears in SCOPe 2.06
  
• d2i5wa2 appears in the current release, SCOPe 2.08