Lineage for d2i5wa2 (2i5w A:12-135)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2538746Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 2538747Superfamily d.129.1: TATA-box binding protein-like [55945] (3 families) (S)
  5. 2538859Family d.129.1.2: DNA repair glycosylase, N-terminal domain [55952] (3 proteins)
    contains a single copy of this fold
  6. 2538900Protein 8-oxoguanine glycosylase [55955] (1 species)
  7. 2538901Species Human (Homo sapiens) [TaxId:9606] [55956] (24 PDB entries)
  8. 2538925Domain d2i5wa2: 2i5w A:12-135 [137070]
    Other proteins in same PDB: d2i5wa1, d2i5wa3
    automatically matched to d1ebma2
    protein/DNA complex; complexed with ca, gol

Details for d2i5wa2

PDB Entry: 2i5w (more details), 2.6 Å

PDB Description: structure of hogg1 crosslinked to dna sampling a normal g adjacent to an oxog
PDB Compounds: (A:) N-glycosylase/DNA lyase

SCOPe Domain Sequences for d2i5wa2:

Sequence, based on SEQRES records: (download)

>d2i5wa2 d.129.1.2 (A:12-135) 8-oxoguanine glycosylase {Human (Homo sapiens) [TaxId: 9606]}
ghrtlastpalwasipcprselrldlvlpsgqsfrwreqspahwsgvladqvwtltqtee
qlhctvyrgdksqasrptpdeleavrkyfqldvtlaqlyhhwgsvdshfqevaqkfqgvr
llrq

Sequence, based on observed residues (ATOM records): (download)

>d2i5wa2 d.129.1.2 (A:12-135) 8-oxoguanine glycosylase {Human (Homo sapiens) [TaxId: 9606]}
ghrtlastpalwasipcprselrldlvlpsgqsfrwreqspahwsgvladqvwtltqtee
qlhctvyrqasrptpdeleavrkyfqldvtlaqlyhhwgsvdshfqevaqkfqgvrllrq

SCOPe Domain Coordinates for d2i5wa2:

Click to download the PDB-style file with coordinates for d2i5wa2.
(The format of our PDB-style files is described here.)

Timeline for d2i5wa2: