SCOP 1.73: Domain d2i5nm1: 2i5n M:1-323

Lineage for d2i5nm1 (2i5n M:1-323)

1. Root: SCOP 1.73

2. Class f: Membrane and cell surface proteins and peptides [56835] (50 folds)

3. Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
   five transmembrane helices forming a sheet-like structure

4. Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family)

5. Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (2 proteins)
   L and M are probably related to each other

6. Protein M (medium) subunit [81481] (3 species)

7. Species Rhodopseudomonas viridis [TaxId:1079] [81478] (10 PDB entries)

8. Domain d2i5nm1: 2i5n M:1-323 [137067]
   Other proteins in same PDB: d2i5nc1, d2i5nh1, d2i5nh2, d2i5nl1
   automatically matched to d1dxrm_
   complexed with bcb, bpb, fe2, hec, hto, lda, mq9, ns5, so4, unl, uq1

Details for d2i5nm1

PDB Entry: 2i5n, 1.96 Å

PDB Description: 1.96 A X-ray structure of photosynthetic reaction center from Rhodopseudomonas viridis:Crystals grown by microfluidic technique

PDB Compounds: (M:) reaction center protein m chain

SCOP Domain Sequences for d2i5nm1:

Sequence; same for both SEQRES and ATOM records:

>d2i5nm1 f.26.1.1 (M:1-323) M (medium) subunit {Rhodopseudomonas viridis [TaxId: 1079]}
adyqtiytqiqargphitvsgewgdndrvgkpfysywlgkigdaqigpiylgasgiaafa
fgstailiilfnmaaevhfdplqffrqffwlglyppkaqygmgipplhdggwwlmaglfm
tlslgswwirvysraralglgthiawnfaaaiffvlcigcihptlvgswsegvpfgiwph
idwltafsirygnfyycpwhgfsigfaygcgllfaahgatilavarfggdreieqitdrg
taveraalfwrwtigfnatiesvhrwgwffslmvmvsasvgilltgtfvdnwylwcvkhg
aapdypaylpatpdpaslpgapk

Timeline for d2i5nm1:

• d2i5nm1 is new in SCOP 1.73
  
• d2i5nm1 appears in SCOP 1.75
  
• d2i5nm1 appears in the current release, SCOPe 2.08, called d2i5nm_