Lineage for d2i5nm_ (2i5n M:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3027280Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
    five transmembrane helices forming a sheet-like structure
  4. 3027281Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) (S)
    automatically mapped to Pfam PF00124
  5. 3027282Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
    L and M are probably related to each other
  6. 3027502Protein automated matches [190224] (17 species)
    not a true protein
  7. 3027503Species Blastochloris viridis [TaxId:1079] [187141] (8 PDB entries)
  8. 3027507Domain d2i5nm_: 2i5n M: [137067]
    Other proteins in same PDB: d2i5nc_, d2i5nh1, d2i5nh2
    automated match to d1dxrm_
    complexed with bcb, bpb, fe2, hec, hto, lda, mq9, ns5, so4, unl, uq1

Details for d2i5nm_

PDB Entry: 2i5n (more details), 1.96 Å

PDB Description: 1.96 A X-ray structure of photosynthetic reaction center from Rhodopseudomonas viridis:Crystals grown by microfluidic technique
PDB Compounds: (M:) reaction center protein m chain

SCOPe Domain Sequences for d2i5nm_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2i5nm_ f.26.1.1 (M:) automated matches {Blastochloris viridis [TaxId: 1079]}
adyqtiytqiqargphitvsgewgdndrvgkpfysywlgkigdaqigpiylgasgiaafa
fgstailiilfnmaaevhfdplqffrqffwlglyppkaqygmgipplhdggwwlmaglfm
tlslgswwirvysraralglgthiawnfaaaiffvlcigcihptlvgswsegvpfgiwph
idwltafsirygnfyycpwhgfsigfaygcgllfaahgatilavarfggdreieqitdrg
taveraalfwrwtigfnatiesvhrwgwffslmvmvsasvgilltgtfvdnwylwcvkhg
aapdypaylpatpdpaslpgapk

SCOPe Domain Coordinates for d2i5nm_:

Click to download the PDB-style file with coordinates for d2i5nm_.
(The format of our PDB-style files is described here.)

Timeline for d2i5nm_: