![]() | Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
![]() | Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily) five transmembrane helices forming a sheet-like structure |
![]() | Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) ![]() automatically mapped to Pfam PF00124 |
![]() | Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins) L and M are probably related to each other |
![]() | Protein automated matches [190224] (17 species) not a true protein |
![]() | Species Blastochloris viridis [TaxId:1079] [187141] (8 PDB entries) |
![]() | Domain d2i5nm_: 2i5n M: [137067] Other proteins in same PDB: d2i5nc_, d2i5nh1, d2i5nh2 automated match to d1dxrm_ complexed with bcb, bpb, fe2, hec, hto, lda, mq9, ns5, so4, unl, uq1 |
PDB Entry: 2i5n (more details), 1.96 Å
SCOPe Domain Sequences for d2i5nm_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2i5nm_ f.26.1.1 (M:) automated matches {Blastochloris viridis [TaxId: 1079]} adyqtiytqiqargphitvsgewgdndrvgkpfysywlgkigdaqigpiylgasgiaafa fgstailiilfnmaaevhfdplqffrqffwlglyppkaqygmgipplhdggwwlmaglfm tlslgswwirvysraralglgthiawnfaaaiffvlcigcihptlvgswsegvpfgiwph idwltafsirygnfyycpwhgfsigfaygcgllfaahgatilavarfggdreieqitdrg taveraalfwrwtigfnatiesvhrwgwffslmvmvsasvgilltgtfvdnwylwcvkhg aapdypaylpatpdpaslpgapk
Timeline for d2i5nm_:
![]() Domains from other chains: (mouse over for more information) d2i5nc_, d2i5nh1, d2i5nh2, d2i5nl_ |