Lineage for d2i5nh1 (2i5n H:37-258)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1790502Fold b.41: PRC-barrel domain [50345] (1 superfamily)
    core: barrel, partly opened; n*=5, S*=8; meander
  4. 1790503Superfamily b.41.1: PRC-barrel domain [50346] (5 families) (S)
  5. 1790504Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (2 proteins)
  6. 1790505Protein Photosynthetic reaction centre [50348] (3 species)
  7. 1790598Species Rhodopseudomonas viridis [TaxId:1079] [50349] (15 PDB entries)
  8. 1790601Domain d2i5nh1: 2i5n H:37-258 [137064]
    Other proteins in same PDB: d2i5nc_, d2i5nh2, d2i5nl_, d2i5nm_
    automated match to d6prch1
    complexed with bcb, bpb, fe2, hec, hto, lda, mq9, ns5, so4, unl, uq1

Details for d2i5nh1

PDB Entry: 2i5n (more details), 1.96 Å

PDB Description: 1.96 A X-ray structure of photosynthetic reaction center from Rhodopseudomonas viridis:Crystals grown by microfluidic technique
PDB Compounds: (H:) reaction center protein h chain

SCOPe Domain Sequences for d2i5nh1:

Sequence, based on SEQRES records: (download)

>d2i5nh1 b.41.1.1 (H:37-258) Photosynthetic reaction centre {Rhodopseudomonas viridis [TaxId: 1079]}
rregyplveplglvklapedgqvyelpypktfvlphggtvtvprrrpetrelklaqtdgf
egaplqptgnplvdavgpasyaeraevvdatvdgkakivplrvatdfsiaegdvdprglp
vvaadgveagtvtdlwvdrsehyfrylelsvagsartaliplgfcdvkkdkivvtsilse
qfanvprlqsrdqitlreedkvsayyaggllyatperaesll

Sequence, based on observed residues (ATOM records): (download)

>d2i5nh1 b.41.1.1 (H:37-258) Photosynthetic reaction centre {Rhodopseudomonas viridis [TaxId: 1079]}
rregyplvepedgqvyelpypktfvlphggtvtvprrrpetrelklaqtdgfegaplqpt
gnplvdavgpasyaeraevvdatvdgkakivplrvatdfsiaegdvdprglpvvaadgve
agtvtdlwvdrsehyfrylelsvagsartaliplgfcdvkkdkivvtsilseqfanvprl
qsrdqitlreedkvsayyaggllyatperaesll

SCOPe Domain Coordinates for d2i5nh1:

Click to download the PDB-style file with coordinates for d2i5nh1.
(The format of our PDB-style files is described here.)

Timeline for d2i5nh1: