![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.41: PRC-barrel domain [50345] (1 superfamily) core: barrel, partly opened; n*=5, S*=8; meander |
![]() | Superfamily b.41.1: PRC-barrel domain [50346] (5 families) ![]() |
![]() | Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (2 proteins) |
![]() | Protein Photosynthetic reaction centre [50348] (4 species) |
![]() | Species Rhodopseudomonas viridis [TaxId:1079] [50349] (26 PDB entries) |
![]() | Domain d2i5nh1: 2i5n H:37-258 [137064] Other proteins in same PDB: d2i5nc_, d2i5nh2, d2i5nl_, d2i5nm_ automated match to d6prch1 complexed with bcb, bpb, fe2, hec, hto, lda, mq9, ns5, so4, unl, uq1 |
PDB Entry: 2i5n (more details), 1.96 Å
SCOPe Domain Sequences for d2i5nh1:
Sequence, based on SEQRES records: (download)
>d2i5nh1 b.41.1.1 (H:37-258) Photosynthetic reaction centre {Rhodopseudomonas viridis [TaxId: 1079]} rregyplveplglvklapedgqvyelpypktfvlphggtvtvprrrpetrelklaqtdgf egaplqptgnplvdavgpasyaeraevvdatvdgkakivplrvatdfsiaegdvdprglp vvaadgveagtvtdlwvdrsehyfrylelsvagsartaliplgfcdvkkdkivvtsilse qfanvprlqsrdqitlreedkvsayyaggllyatperaesll
>d2i5nh1 b.41.1.1 (H:37-258) Photosynthetic reaction centre {Rhodopseudomonas viridis [TaxId: 1079]} rregyplvepedgqvyelpypktfvlphggtvtvprrrpetrelklaqtdgfegaplqpt gnplvdavgpasyaeraevvdatvdgkakivplrvatdfsiaegdvdprglpvvaadgve agtvtdlwvdrsehyfrylelsvagsartaliplgfcdvkkdkivvtsilseqfanvprl qsrdqitlreedkvsayyaggllyatperaesll
Timeline for d2i5nh1: