SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2i5nc_ (2i5n C:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2012598Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
    variable number of helices and little beta structure; not a true fold
  4. 2012599Superfamily a.138.1: Multiheme cytochromes [48695] (4 families) (S)
    duplication: contains multiple CxxCH motifs
  5. 2012705Family a.138.1.2: Photosynthetic reaction centre (cytochrome subunit) [48707] (2 protein domains)
    consists of four heme-binding repeats
    automatically mapped to Pfam PF02276
  6. 2012706Protein Photosynthetic reaction centre (cytochrome subunit) [48708] (2 species)
  7. 2012707Species Rhodopseudomonas viridis [TaxId:1079] [48709] (19 PDB entries)
  8. 2012710Domain d2i5nc_: 2i5n C: [137063]
    Other proteins in same PDB: d2i5nh1, d2i5nh2, d2i5nl_, d2i5nm_
    automated match to d1prcc_
    complexed with bcb, bpb, fe2, hec, hto, lda, mq9, ns5, so4, unl, uq1

Details for d2i5nc_

PDB Entry: 2i5n (more details), 1.96 Å

PDB Description: 1.96 A X-ray structure of photosynthetic reaction center from Rhodopseudomonas viridis:Crystals grown by microfluidic technique
PDB Compounds: (C:) Photosynthetic reaction center cytochrome c subunit

SCOPe Domain Sequences for d2i5nc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2i5nc_ a.138.1.2 (C:) Photosynthetic reaction centre (cytochrome subunit) {Rhodopseudomonas viridis [TaxId: 1079]}
cfepppatttqtgfrglsmgevlhpatvkakkerdaqyppalaavkaegppvsqvyknvk
vlgnlteaeflrtmtaitewvspqegctychdennlaseakypyvvarrmlemtraintn
wtqhvaqtgvtcytchrgtplppyvryleptlplnnretpthvervetrsgyvvrlakyt
aysalnydpftmflandkrqvrvvpqtalplvgvsrgkerrplsdayatfalmmsisdsl
gtnctfchnaqtfeswgkkstpqraiawwgirmvrdlnmnylaplnaslpasrlgrqgea
pqadcrtchqgvtkplfgasrlkdypelgpik

SCOPe Domain Coordinates for d2i5nc_:

Click to download the PDB-style file with coordinates for d2i5nc_.
(The format of our PDB-style files is described here.)

Timeline for d2i5nc_: