Lineage for d2i5nc_ (2i5n C:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2012598Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
    variable number of helices and little beta structure; not a true fold
  4. 2012599Superfamily a.138.1: Multiheme cytochromes [48695] (4 families) (S)
    duplication: contains multiple CxxCH motifs
  5. 2012705Family a.138.1.2: Photosynthetic reaction centre (cytochrome subunit) [48707] (2 protein domains)
    consists of four heme-binding repeats
    automatically mapped to Pfam PF02276
  6. 2012706Protein Photosynthetic reaction centre (cytochrome subunit) [48708] (2 species)
  7. 2012707Species Rhodopseudomonas viridis [TaxId:1079] [48709] (19 PDB entries)
  8. 2012710Domain d2i5nc_: 2i5n C: [137063]
    Other proteins in same PDB: d2i5nh1, d2i5nh2, d2i5nl_, d2i5nm_
    automated match to d1prcc_
    complexed with bcb, bpb, fe2, hec, hto, lda, mq9, ns5, so4, unl, uq1

Details for d2i5nc_

PDB Entry: 2i5n (more details), 1.96 Å

PDB Description: 1.96 A X-ray structure of photosynthetic reaction center from Rhodopseudomonas viridis:Crystals grown by microfluidic technique
PDB Compounds: (C:) Photosynthetic reaction center cytochrome c subunit

SCOPe Domain Sequences for d2i5nc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2i5nc_ a.138.1.2 (C:) Photosynthetic reaction centre (cytochrome subunit) {Rhodopseudomonas viridis [TaxId: 1079]}
cfepppatttqtgfrglsmgevlhpatvkakkerdaqyppalaavkaegppvsqvyknvk
vlgnlteaeflrtmtaitewvspqegctychdennlaseakypyvvarrmlemtraintn
wtqhvaqtgvtcytchrgtplppyvryleptlplnnretpthvervetrsgyvvrlakyt
aysalnydpftmflandkrqvrvvpqtalplvgvsrgkerrplsdayatfalmmsisdsl
gtnctfchnaqtfeswgkkstpqraiawwgirmvrdlnmnylaplnaslpasrlgrqgea
pqadcrtchqgvtkplfgasrlkdypelgpik

SCOPe Domain Coordinates for d2i5nc_:

Click to download the PDB-style file with coordinates for d2i5nc_.
(The format of our PDB-style files is described here.)

Timeline for d2i5nc_: