Lineage for d2i52e2 (2i52 E:2-120)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3010677Fold d.316: MK0786-like [143559] (1 superfamily)
    alpha(2)-beta(4); 2 layers: a/b; antiparallel beta-sheet, order 1234 (meander)
  4. 3010678Superfamily d.316.1: MK0786-like [143560] (2 families) (S)
    probable biological unit is a teramer; all subunit interfaces are provided by helices
  5. 3010679Family d.316.1.1: MK0786-like [143561] (2 proteins)
    single domain; the N-terminal half is covered by Pfam PF04036 (DUF372) and the C-terminal half by Pfam PF04038 (DUF381)
  6. 3010686Protein Hypothetical protein PTO0218 [143562] (1 species)
  7. 3010687Species Picrophilus torridus [TaxId:82076] [143563] (1 PDB entry)
    Uniprot Q6L2J9 1-120
  8. 3010692Domain d2i52e2: 2i52 E:2-120 [137059]
    Other proteins in same PDB: d2i52a2, d2i52b3, d2i52c3, d2i52d3, d2i52e3, d2i52f3
    automated match to d2i52a1
    complexed with ca, cl, gol

Details for d2i52e2

PDB Entry: 2i52 (more details), 2.08 Å

PDB Description: crystal structure of protein pto0218 from picrophilus torridus, pfam duf372
PDB Compounds: (E:) hypothetical protein

SCOPe Domain Sequences for d2i52e2:

Sequence, based on SEQRES records: (download)

>d2i52e2 d.316.1.1 (E:2-120) Hypothetical protein PTO0218 {Picrophilus torridus [TaxId: 82076]}
ydpaekyfnctdiqraffeagiklgaifhqytgipvnsenasmaeefierstmiqpfven
vrisinnvkrssgtysysslnekmlhaevlinyngkkvlgvlnydegldypvmyakevl

Sequence, based on observed residues (ATOM records): (download)

>d2i52e2 d.316.1.1 (E:2-120) Hypothetical protein PTO0218 {Picrophilus torridus [TaxId: 82076]}
ydpaekyfnctdiqraffeagiklgaifhqytgipvnsenasmaeefierstmiqpfven
vrisinnvysysslnekmlhaevlinyngkkvlgvlnydegldypvmyakevl

SCOPe Domain Coordinates for d2i52e2:

Click to download the PDB-style file with coordinates for d2i52e2.
(The format of our PDB-style files is described here.)

Timeline for d2i52e2: