SCOPe 2.01: Domain d2i52d_: 2i52 D:

Lineage for d2i52d_ (2i52 D:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.316: MK0786-like [143559] (1 superfamily)
   alpha(2)-beta(4); 2 layers: a/b; antiparallel beta-sheet, order 1234 (meander)

4. Superfamily d.316.1: MK0786-like [143560] (2 families)
   probable biological unit is a teramer; all subunit interfaces are provided by helices

5. Family d.316.1.1: MK0786-like [143561] (2 proteins)
   single domain; the N-terminal half is covered by Pfam PF04036 (DUF372) and the C-terminal half by Pfam PF04038 (DUF381)

6. Protein Hypothetical protein PTO0218 [143562] (1 species)

7. Species Picrophilus torridus [TaxId:82076] [143563] (1 PDB entry)
   Uniprot Q6L2J9 1-120

8. Domain d2i52d_: 2i52 D: [137058]
   automated match to d2i52a1
   complexed with ca, cl, gol

Details for d2i52d_

PDB Entry: 2i52, 2.08 Å

PDB Description: crystal structure of protein pto0218 from picrophilus torridus, pfam duf372

PDB Compounds: (D:) hypothetical protein

SCOPe Domain Sequences for d2i52d_:

Sequence, based on SEQRES records:

>d2i52d_ d.316.1.1 (D:) Hypothetical protein PTO0218 {Picrophilus torridus [TaxId: 82076]}
slydpaekyfnctdiqraffeagiklgaifhqytgipvnsenasmaeefierstmiqpfv
envrisinnvkrssgtysysslnekmlhaevlinyngkkvlgvlnydegldypvmyakev
l

Sequence, based on observed residues (ATOM records):

>d2i52d_ d.316.1.1 (D:) Hypothetical protein PTO0218 {Picrophilus torridus [TaxId: 82076]}
slydpaekyfnctdiqraffeagiklgaifhqytgipvnsenasmaeefierstmiqpfv
envrisinnsgtysysslnekmlhaevlinyngkkvlgvlnydegldypvmyakevl

Timeline for d2i52d_:

• d2i52d_ first appeared in SCOP 1.73, called d2i52d1
  
• d2i52d_ was called d2i52d1 in SCOP 1.75
  
• d2i52d_ appears in SCOPe 2.02
  
• d2i52d_ appears in the current release, SCOPe 2.08, called d2i52d2