SCOP 1.73: Domain d2i52d1: 2i52 D:1-120

Lineage for d2i52d1 (2i52 D:1-120)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.316: MK0786-like [143559] (1 superfamily)
   alpha(2)-beta(4); 2 layers: a/b; antiparallel beta-sheet, order 1234 (meander)

4. Superfamily d.316.1: MK0786-like [143560] (1 family)
   probable biological unit is a teramer; all subunit interfaces are provided by helices

5. Family d.316.1.1: MK0786-like [143561] (2 proteins)
   single domain; the N-terminal half is covered by Pfam PF04036 (DUF372) and the C-terminal half by Pfam 04038 (DUF381)

6. Protein Hypothetical protein PTO0218 [143562] (1 species)

7. Species Picrophilus torridus [TaxId:82076] [143563] (1 PDB entry)

8. Domain d2i52d1: 2i52 D:1-120 [137058]
   automatically matched to 2I52 A:1-120
   complexed with ca, cl, gol

Details for d2i52d1

PDB Entry: 2i52, 2.08 Å

PDB Description: crystal structure of protein pto0218 from picrophilus torridus, pfam duf372

PDB Compounds: (D:) hypothetical protein

SCOP Domain Sequences for d2i52d1:

Sequence, based on SEQRES records:

>d2i52d1 d.316.1.1 (D:1-120) Hypothetical protein PTO0218 {Picrophilus torridus [TaxId: 82076]}
lydpaekyfnctdiqraffeagiklgaifhqytgipvnsenasmaeefierstmiqpfve
nvrisinnvkrssgtysysslnekmlhaevlinyngkkvlgvlnydegldypvmyakevl

Sequence, based on observed residues (ATOM records):

>d2i52d1 d.316.1.1 (D:1-120) Hypothetical protein PTO0218 {Picrophilus torridus [TaxId: 82076]}
lydpaekyfnctdiqraffeagiklgaifhqytgipvnsenasmaeefierstmiqpfve
nvrisinnsgtysysslnekmlhaevlinyngkkvlgvlnydegldypvmyakevl

Timeline for d2i52d1:

• d2i52d1 is new in SCOP 1.73
  
• d2i52d1 appears in SCOP 1.75
  
• d2i52d1 appears in the current release, SCOPe 2.08, called d2i52d2