Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.316: MK0786-like [143559] (1 superfamily) alpha(2)-beta(4); 2 layers: a/b; antiparallel beta-sheet, order 1234 (meander) |
Superfamily d.316.1: MK0786-like [143560] (2 families) probable biological unit is a teramer; all subunit interfaces are provided by helices |
Family d.316.1.1: MK0786-like [143561] (2 proteins) single domain; the N-terminal half is covered by Pfam PF04036 (DUF372) and the C-terminal half by Pfam PF04038 (DUF381) |
Protein Hypothetical protein PTO0218 [143562] (1 species) |
Species Picrophilus torridus [TaxId:82076] [143563] (1 PDB entry) Uniprot Q6L2J9 1-120 |
Domain d2i52d2: 2i52 D:2-120 [137058] Other proteins in same PDB: d2i52a2, d2i52b3, d2i52c3, d2i52d3, d2i52e3, d2i52f3 automated match to d2i52a1 complexed with ca, cl, gol |
PDB Entry: 2i52 (more details), 2.08 Å
SCOPe Domain Sequences for d2i52d2:
Sequence, based on SEQRES records: (download)
>d2i52d2 d.316.1.1 (D:2-120) Hypothetical protein PTO0218 {Picrophilus torridus [TaxId: 82076]} ydpaekyfnctdiqraffeagiklgaifhqytgipvnsenasmaeefierstmiqpfven vrisinnvkrssgtysysslnekmlhaevlinyngkkvlgvlnydegldypvmyakevl
>d2i52d2 d.316.1.1 (D:2-120) Hypothetical protein PTO0218 {Picrophilus torridus [TaxId: 82076]} ydpaekyfnctdiqraffeagiklgaifhqytgipvnsenasmaeefierstmiqpfven vrisinnsgtysysslnekmlhaevlinyngkkvlgvlnydegldypvmyakevl
Timeline for d2i52d2: