Lineage for d2i52c1 (2i52 C:1-120)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 741751Fold d.316: MK0786-like [143559] (1 superfamily)
    alpha(2)-beta(4); 2 layers: a/b; antiparallel beta-sheet, order 1234 (meander)
  4. 741752Superfamily d.316.1: MK0786-like [143560] (1 family) (S)
    probable biological unit is a teramer; all subunit interfaces are provided by helices
  5. 741753Family d.316.1.1: MK0786-like [143561] (2 proteins)
    single domain; the N-terminal half is covered by Pfam PF04036 (DUF372) and the C-terminal half by Pfam 04038 (DUF381)
  6. 741760Protein Hypothetical protein PTO0218 [143562] (1 species)
  7. 741761Species Picrophilus torridus [TaxId:82076] [143563] (1 PDB entry)
  8. 741764Domain d2i52c1: 2i52 C:1-120 [137057]
    automatically matched to 2I52 A:1-120
    complexed with ca, cl, gol

Details for d2i52c1

PDB Entry: 2i52 (more details), 2.08 Å

PDB Description: crystal structure of protein pto0218 from picrophilus torridus, pfam duf372
PDB Compounds: (C:) hypothetical protein

SCOP Domain Sequences for d2i52c1:

Sequence, based on SEQRES records: (download)

>d2i52c1 d.316.1.1 (C:1-120) Hypothetical protein PTO0218 {Picrophilus torridus [TaxId: 82076]}
lydpaekyfnctdiqraffeagiklgaifhqytgipvnsenasmaeefierstmiqpfve
nvrisinnvkrssgtysysslnekmlhaevlinyngkkvlgvlnydegldypvmyakevl

Sequence, based on observed residues (ATOM records): (download)

>d2i52c1 d.316.1.1 (C:1-120) Hypothetical protein PTO0218 {Picrophilus torridus [TaxId: 82076]}
lydpaekyfnctdiqraffeagiklgaifhqytgipvnsenasmaeefierstmiqpfve
nvrisinnvysysslnekmlhaevlinyngkkvlgvlnydegldypvmyakevl

SCOP Domain Coordinates for d2i52c1:

Click to download the PDB-style file with coordinates for d2i52c1.
(The format of our PDB-style files is described here.)

Timeline for d2i52c1: