Lineage for d2i52b1 (2i52 B:1-120)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 882437Fold d.316: MK0786-like [143559] (1 superfamily)
    alpha(2)-beta(4); 2 layers: a/b; antiparallel beta-sheet, order 1234 (meander)
  4. 882438Superfamily d.316.1: MK0786-like [143560] (1 family) (S)
    probable biological unit is a teramer; all subunit interfaces are provided by helices
  5. 882439Family d.316.1.1: MK0786-like [143561] (2 proteins)
    single domain; the N-terminal half is covered by Pfam PF04036 (DUF372) and the C-terminal half by Pfam PF04038 (DUF381)
  6. 882446Protein Hypothetical protein PTO0218 [143562] (1 species)
  7. 882447Species Picrophilus torridus [TaxId:82076] [143563] (1 PDB entry)
    Uniprot Q6L2J9 1-120
  8. 882449Domain d2i52b1: 2i52 B:1-120 [137056]
    automatically matched to 2I52 A:1-120
    complexed with ca, cl, gol

Details for d2i52b1

PDB Entry: 2i52 (more details), 2.08 Å

PDB Description: crystal structure of protein pto0218 from picrophilus torridus, pfam duf372
PDB Compounds: (B:) hypothetical protein

SCOP Domain Sequences for d2i52b1:

Sequence, based on SEQRES records: (download)

>d2i52b1 d.316.1.1 (B:1-120) Hypothetical protein PTO0218 {Picrophilus torridus [TaxId: 82076]}
lydpaekyfnctdiqraffeagiklgaifhqytgipvnsenasmaeefierstmiqpfve
nvrisinnvkrssgtysysslnekmlhaevlinyngkkvlgvlnydegldypvmyakevl

Sequence, based on observed residues (ATOM records): (download)

>d2i52b1 d.316.1.1 (B:1-120) Hypothetical protein PTO0218 {Picrophilus torridus [TaxId: 82076]}
lydpaekyfnctdiqraffeagiklgaifhqytgipvnsenasmaeefierstmiqpfve
nvrisinnvkysysslnekmlhaevlinyngkkvlgvlnydegldypvmyakevl

SCOP Domain Coordinates for d2i52b1:

Click to download the PDB-style file with coordinates for d2i52b1.
(The format of our PDB-style files is described here.)

Timeline for d2i52b1: